Sharp AQUOS LC-32D59U инструкция обслуживания
- Просмотреть online или скачать инструкцию
- 157 страниц
- 11.02 mb
Идти на страницу of
Похожие руководства по эксплуатации
-
Flat Panel Television
Sharp LC-60LE835X
84 страниц 5.26 mb -
Flat Panel Television
Sharp LC42LE772EN
41 страниц 3.11 mb -
Flat Panel Television
Sharp Aquos LC 30HV6U
86 страниц 3.53 mb -
Flat Panel Television
Sharp LC-24LE250V-BK
27 страниц 2.03 mb -
Flat Panel Television
Sharp LC-32DA5U
54 страниц 9.14 mb -
Flat Panel Television
Sharp LC 10A2U
35 страниц 2.2 mb -
Flat Panel Television
Sharp LC-39LE654E/V
64 страниц 11.25 mb -
Flat Panel Television
Sharp LC-20SH21U
36 страниц 4.1 mb
Хорошее руководство по эксплуатации
Законодательство обязывает продавца передать покупателю, вместе с товаром, руководство по эксплуатации Sharp AQUOS LC-32D59U. Отсутствие инструкции либо неправильная информация, переданная потребителю, составляют основание для рекламации в связи с несоответствием устройства с договором. В законодательстве допускается предоставлении руководства в другой, чем бумажная форме, что, в последнее время, часто используется, предоставляя графическую или электронную форму инструкции Sharp AQUOS LC-32D59U или обучающее видео для пользователей. Условием остается четкая и понятная форма.
Что такое руководство?
Слово происходит от латинского "instructio", тоесть привести в порядок. Следовательно в инструкции Sharp AQUOS LC-32D59U можно найти описание этапов поведения. Цель инструкции заключается в облегчении запуска, использования оборудования либо выполнения определенной деятельности. Инструкция является набором информации о предмете/услуге, подсказкой.
К сожалению немного пользователей находит время для чтения инструкций Sharp AQUOS LC-32D59U, и хорошая инструкция позволяет не только узнать ряд дополнительных функций приобретенного устройства, но и позволяет избежать возникновения большинства поломок.
Из чего должно состоять идеальное руководство по эксплуатации?
Прежде всего в инструкции Sharp AQUOS LC-32D59U должна находится:
- информация относительно технических данных устройства Sharp AQUOS LC-32D59U
- название производителя и год производства оборудования Sharp AQUOS LC-32D59U
- правила обслуживания, настройки и ухода за оборудованием Sharp AQUOS LC-32D59U
- знаки безопасности и сертификаты, подтверждающие соответствие стандартам
Почему мы не читаем инструкций?
Как правило из-за нехватки времени и уверенности в отдельных функциональностях приобретенных устройств. К сожалению само подсоединение и запуск Sharp AQUOS LC-32D59U это слишком мало. Инструкция заключает ряд отдельных указаний, касающихся функциональности, принципов безопасности, способов ухода (даже то, какие средства стоит использовать), возможных поломок Sharp AQUOS LC-32D59U и способов решения проблем, возникающих во время использования. И наконец то, в инструкции можно найти адресные данные сайта Sharp, в случае отсутствия эффективности предлагаемых решений. Сейчас очень большой популярностью пользуются инструкции в форме интересных анимаций или видео материалов, которое лучше, чем брошюра воспринимаются пользователем. Такой вид инструкции позволяет пользователю просмотреть весь фильм, не пропуская спецификацию и сложные технические описания Sharp AQUOS LC-32D59U, как это часто бывает в случае бумажной версии.
Почему стоит читать инструкции?
Прежде всего здесь мы найдем ответы касательно конструкции, возможностей устройства Sharp AQUOS LC-32D59U, использования отдельных аксессуаров и ряд информации, позволяющей вполне использовать все функции и упрощения.
После удачной покупки оборудования/устройства стоит посвятить несколько минут для ознакомления с каждой частью инструкции Sharp AQUOS LC-32D59U. Сейчас их старательно готовят или переводят, чтобы они были не только понятными для пользователя, но и чтобы выполняли свою основную информационно-поддерживающую функцию.
Содержание руководства
-
Страница 1
ENGLISH IMPORTANT : Please read this operation manual before starting operating the equipment. IMPORTANT : Veuillez lire ce mode d’emploi avant de commencer à utilliser l’appareil. IMPORTANTE : Lea este manual de operación antes de comenzar a operar el equipo. O P E R AT I O N M A N U A L MODE D'EMPL OI MANU AL DE OP ER A C IÓN LIQUID C[...]
-
Страница 2
[...]
-
Страница 3
1 OPERATION MANUAL IMPORTANT: To aid reporting in case of loss or theft, please record the TV's model and serial numbers in the space provided. The numbers are located at the rear of the TV. Model No.: Serial No.: LIQUID CRYSTAL TELEVISION ENGLISH IMPORTANT INFORMATION ENGLISH WARNING: TO REDUCE THE RISK OF FIRE OR ELECTRIC SHOCK, DO NOT EXPOS[...]
-
Страница 4
2 IMPORTANT INFORMATION TRADEMARKS WARNING: FCC Regulations state that any unauthorized changes or modi fi cations to this equipment not expressly appr oved by the manufacturer could void the user’ s authority to operate this equipment. CAUTION: This product satis fi es FCC r egulations when shielded cables and connectors are used to connect th[...]
-
Страница 5
3 Thank you for your purchase of the Sharp Liquid Crystal Television. To ensure safety and many years of trouble-free operation of your product, please read the Important Safety Instructions carefully before using this product. DEAR SHARP CUSTOMER IMPORTANT SAFETY INSTRUCTIONS Electricity is used to perform many useful functions, but it can also ca[...]
-
Страница 6
4 IMPORTANT SAFETY INSTRUCTIONS 18) Damage Requiring Service—Unplug this product from the wall outlet and r efer servicing to qualified service personnel under the following conditions: a) When the AC cord or plug is damaged, b) If liquid has been spilled, or objects have fallen into the product, c) If the product has been exposed to rain or wat[...]
-
Страница 7
5 IMPORTANT SAFETY INSTRUCTIONS Water and Moisture — Do not use this product near water - for example, near a bath tub, wash • bowl, kitchen sink, or laundry tub; in a wet basement; or near a swimming pool; and the like. Stand — Do not place the product on an unstable cart, stand, tripod or table. Placing the • product on an unstable base c[...]
-
Страница 8
6 IMPORTANT SAFETY INSTRUCTIONS Caring for the Cabinet Use a soft cloth (cotton, fl annel, etc.) and gently wipe the surface of the cabinet. • Using a chemical cloth (wet/dry sheet type cloth, etc.) may deform the components of the main • unit cabinet or cause cracking. Wiping with a hard cloth or using strong force may scratch the surface of [...]
-
Страница 9
7 IMPORTANT SAFETY INSTRUCTIONS CHILD SAFETY It Makes A Differ ence How and Where Y ou Use Y our Flat Panel Display Congratulations on your purchase! As you enjoy your new pr oduct, please keep these safety tips in mind: THE ISSUE The home theater entertainment experience is a growing trend and larger • fl at panel displays are popular purchases[...]
-
Страница 10
8 QUICK REFERENCE Supplied Accessories Always use the AC cord supplied with the TV. • The illustrations above are for explanation purposes and may vary slightly from the • actual accessories. Make sure the following accessories are provided with the product. Remote control unit ( X 1) Page 11 “AAA” size battery ( X 2) Page 13 AC cord ( X 1)[...]
-
Страница 11
Stand Cover 32’’/42’’ 9 QUICK REFERENCE Detaching the stand neck for wall mounting CAUTION Please use care when disassembling cabinet, stand, and pillar for wall • mounting. Detach the stand neck in the correct direction. • Do not remove the stand neck from the TV unless using an optional wall mount • bracket to mount it. Loosen the 4[...]
-
Страница 12
10 Quick Installation Tips Attach your antenna to the back of the television. (See page 12.) How t o turn o n the televisio n for th e ? rs t time . A) Press POWER on the television. B) The POWER indicator on the front of the television lights off. Connect the AC plug for the television into the AC outlet. Speakers cannot be detached from the • T[...]
-
Страница 13
POWER indicator Remote Control sensor 30º (5m) Horizontal & Vertical (8 m) 0º 45º (4m) Horizontal only IN P U T 4 5 6 7 8 9 0 E N T 2 D IS P L AY FR E E Z E FLASHBACK MU T E S UR RO U N D TV U S B P C M E NU FAV O R I T E C H S L E E P C C VIEW MODEAV M O DE AUD I O VO L C H + LCD TV G J 221 A B C D 11 Using the Remote Control Unit Use the r[...]
-
Страница 14
12 Antennas To enjoy a clearer picture, use an outdoor antenna. The following is a brief explanation of the types of connections that are used for a coaxial cable. If your outdoor antenna uses a 75-ohm coaxial cable with an F-type connector, plug it into the antenna terminal at the rear of the TV set. A 75-ohm system is generally a round 1. cable w[...]
-
Страница 15
13 Installing Batteries in the Remote Control Unit CAUTION Improper use of batteries can result in chemical leakage or explosion. Be sure to follow the instructions below. Do not mix batteries of different types. Different types of batteries have different • characteristics. Do not mix old and new batteries. Mixing old and new batteries can short[...]
-
Страница 16
14 Contents Dimensional Drawings The dimensional drawings for the LCD TV set are shown on the inside back cover. • IMPORTANT INF ORMATION ...................................................................................... 1 TRADEMARKS ............................................................................................................. [...]
-
Страница 17
15 Part Names TV (Front) TV (Side/Rear) *1: See pages 19, 20, 21 and 22 for external equipment connection. *2: See page 18 ,23,25 and 31 for button operations. *3: See page 10 for connecting the AC cord. The illustrations in this operation manual are for explanation purposes and may vary slightly from • the actual operations. *2 *1 Y Y PB PB PR P[...]
-
Страница 18
16 Remote Control Unit Part Names When using the remote control unit, • point it at the TV. POWER: 1 Switch the power on or enters standby mode. (See page 19.) 3 INPUT: Select a TV input source. (See page 25.) 4 5 • (DOT): (See page 25.) 6 DISPLAY: Display the current channel (or input source) information on the screen. 7 VOL , / . : Set the vo[...]
-
Страница 19
17 Introduction to Connections Experiencing HD Images An HDTV without an HD source is just an ordinary TV. To enjoy HD images on the TV, you should get HD programming from the following: Over-the-air broadcasting via HD quality antenna HD cable/satellite subscription HD compatible external equipment For information on updating to HD programming, as[...]
-
Страница 20
18 1 Press INPUT . The CH List screen displays. 2 Press / to select the input source. You can also select the input source by pressing INPUT . Each time INPUT the input source toggles. INPUT1 INPUT2 INPUT3 INPUT7 TV An image from the selected source automatically displays. • • • Example Example Displaying an External Equipment Image Display T[...]
-
Страница 21
19 Connecting to External Equipment You can connect many types of external equipment to your TV. To view external source images, select the input source from INPUT on the remote control unit or on the TV. available cables. CAUTION • To protect equipment, always turn off the TV before connecting any external equipment. • Please read the relevant[...]
-
Страница 22
20 Connecting to External Equipment When using Component cable (INPUT 5,6): • Blu-ray disc player • DVD player • HD cable/satellite set-top box • To enjoy 1080p display capability, connect your external equipment using an HDMI-certifi ed cable or a component cable and set the equipment to 1080p output. • See page 19 for connecting a Blu-[...]
-
Страница 23
21 Connecting to External Equipment Connecting an Audio Amplifier When using coaxial cable: It is possible to output audio through the DIGITAL AUDIO terminal.PCM audio outputs from the terminal. Connecting an AV Amplifier • If the image is not in sync with the audio, check the settings of the connected surround system. • Letting the TV output[...]
-
Страница 24
Connecting a PC Refer to page 46 for a list of PC signals compatible with the TV. When using HDMI cable (INPUT 1, 2, 3 or 4): • The HDMI terminals only support digital signal. When using DVI-HDMI conversion cable (INPUT 1,2,3,4): • When using a DVI-HDMI conversion cable, you should make an analog audio connection. In this case, in addition to c[...]
-
Страница 25
Turning On/Off the Power Initial Setup Watching TV When you turn on the TV for the fi rst time, the Initial Setup will guide you through the setup process. Perform the following steps before you press POWER on the remote control unit. Insert the batteries into the remote 1. control unit. (See page 13.) Connect the antenna cable to the TV. 2. (See [...]
-
Страница 26
Watching TV 3. Location setting Press • to select “Home” or “Store” and press to the next step. 4. Time Zone setting Press • to select your current location for time zone. 5. Tuner setting Make sure what kind of connection • is made with your TV when selecting “Air” or “Cable”. Press • to select “Air” or “Cable” and [...]
-
Страница 27
Direct Button Operation An image from the selected source • automatically displays. Each time • INPUT is pressed, the input source toggles. If you press • to select the input source, press ENTER to con fi rm your selection. connection. MUTE Mutes the current sound output. Press MUTE . Mute can be canceled by using the • method below. - Mut[...]
-
Страница 28
Direct Button Operation FLASHBACK Press FLASHBACK to switch to the previously tuned channel or input. Press • FLASHBACK again to switch back to the currently tuned channel or input. SURROUND The surround function produces Surround effect from the speakers. Each time you press SURROUND , the mode changes between On and Off. • On: Makes it possib[...]
-
Страница 29
Direct Button Operation ■ Digital broadcasting audio mode The types of audio transmitted in a digital broadcast include SURROUND as well as MONO and STEREO. In addition, it is possible for multiple audio tracks to accompany a single video track. Press MTS/SAP to toggle between audio modes. Example: when receiving Digital broadcasting STEREO (Audi[...]
-
Страница 30
28 Direct Button Operation VIEW MODE You can select the screen size. 1 Press VIEW MODE . The View Mode menu displays. The menu lists the View Mode options selectable for the type of video signal currently being received. 2 Press VIEW MODE or / while the View Mode menu is displayed to select a desired item on the menu. You can sequentially select a [...]
-
Страница 31
For TV Mode Some menu items may not be displayed depending on the selected input source. • On-Screen Display Menu Menu Items Video Menu ........................................................... 31 AV Mode ................................................................. 32 Color Temperature .................................................. 32 [...]
-
Страница 32
Example Item displayed in yellow This indicates the item currently • selected. Press • to go to the adjustment screen for this item. Item displayed in blue This indicates that the item can be • selected. Item displayed in box This indicates the item currently • selected. Menu options differ in the selected input • modes, but the operating[...]
-
Страница 33
On-Screen Display Menu Using the remote control Use the following buttons on the remote control to operate the menu. MENU : Press to open or close the menu screen. : Press to select a desired item on the screen or adjust a selected item. ENTER: Press to go to the next step or complete the setting. RETURN: Press to return to the previous step. Using[...]
-
Страница 34
On-Screen Display Menu AV Mode Adjust the best picture appearance fr om selecting the preset value of Standar d , Movie , Power Saver , User , or Dynamic . . Color Temperature For a better white balance, use color temperature corr ection. Warm: White with reddish tone Standard: Cool: White with bluish tone • User: White balance can be adjusted ma[...]
-
Страница 35
Audio Menu Adjusts the sound quality to your prefer ence with the following settings. Example Press 1. MENU to display the MENU screen, and then press to select “Audio” and press ENTER or to enter it. Press 2. to select a speci fi c adjustment item and press ENTER or ► to set. Press 3. to adjust the desired setting. Press 4. MENU to exit. Se[...]
-
Страница 36
On-Screen Display Menu TV Menu Example Press 1. MENU to display the MENU screen, and then press to select “TV” and press ENTER or to enter it. Press 2. to select a speci fi c item and press ENTER or to set the item. Press 3. MENU to exit. Tuner Mode Select TV source signal fr om the Air (antenna) or Cable (CA TV). Auto CH Search If initial set[...]
-
Страница 37
Setup Menu Example Press 1. MENU to display the MENU screen, and then press to select “Setup” and press ENTER or to enter it. Press 2. to select a speci fi c item and press ENTER or to set the item. Press 3. MENU to exit. OSD Language Select the OSD menu display language. (English/Français/Español) View mode Change the format of the picture.[...]
-
Страница 38
On-Screen Display Menu Digital Closed Caption This allows you to con fi gure the way you choose to view digital captioning. Select one of the digital service channels made available by the caption provider . There ar e six standard services. Service 1 is designated as the Primary Caption Service. This service contains the verbatim, or near -verbat[...]
-
Страница 39
Parental Menu Before entering the Par ental Control sub-menu, user has to key in the passwor d fi rst. After entering the parental sub-menu, the user can modify the r estricted table. While exiting the sub-menu, the parental contr ol function is activated. Enter a 4-digit password with the number buttons on the r emote control. The default passwor[...]
-
Страница 40
On-Screen Display Menu Rating Enable Set the Enable Rating to On to activate the program rating system. U.S. TV Ratings If you are r eceiving channels through a set-top box or cable r eceiver box connected by HDMI, you cannot use the TV ratings lock. Y our set-top box or cable receiver box must be connected through RF or A V connectors. Age rating [...]
-
Страница 41
U.S. Movie Ratings This section describes how to control viewing of movies based on their Motion Pictur e Association of America (MP AA) rating. Movie rating Description G General audiences. All ages admitted. PG Parental guidance suggested. Some material may not be suitable for children. PG-13 Parents str ongly cautioned. Some material may be inap[...]
-
Страница 42
Movie rating Description 14+ Over 14 years: Could contain themes where violence is one of the dominant elements of the storyline, but it must be integral to the development of plot or character . Language usage could be profane and nudity present within the context of the theme. 18+ Adults: Intended for viewers 18 years and older and might contain [...]
-
Страница 43
This TV is fi tted with a USB connector that enables you to view photos ˈ play music and play video that stored on a USB storage device. Browse the fi le folder Press 1. USB direct button.The USB thumbnail browser appears. Photo File name 1 Media Type Size Sort 01/01 File name 1 File name 2 File name 3 File name 4 File name 5 Press 2. MENU to di[...]
-
Страница 44
View Photos In the photo thumbnail browser, press 1. to select a photo or a photo album. Press 2. ENTER to view a full screen image. The slide show begins. When the slide show begins, use the 3. color buttons on the remote control and follow the on-screen instructions to view photos. Press 4. MENU to display the sub-menu. You can select the followi[...]
-
Страница 45
Play Video In the fi le thumbnail browser, press 1. to select a video fi le. Press 2. ENTER to play the video fi le. 3. Press . MENU to display the sub-menu and select the following options to operate. Pause • Repeat • Show Info • AV Mode • View Mode • You can also use the short keys on the • remote control to operate. USB ϧ / ϰ //[...]
-
Страница 46
Troubleshooting Appendix Problem Possible Solution No power s Check if you pressed s POWER on the remote control unit. press POWER on the TV. Is the AC cord disconnected? (See page 10.) s Unit cannot be s operated. External influences such as lightning, static electricity, may s cause improper operation. In this case, operate the unit after first[...]
-
Страница 47
Speci fi cations Item LC-32D59U LC-42D69U LCD screen size 32” Class (31 1/2” Diagonal) Resolution 1,049,088 pixels (1,366 x 768) 2,073,600 pixels (1,920 x 1080) TV Function Receiving System American TV Standard ATSC/NTSC System Receiving Channel VHF/UHF VHF 2-13ch, UHF 14-69ch CATV 1-125ch (non-scrambled channel only) Digital Terrestrial Broad[...]
-
Страница 48
PC Compatibility Chart It is necessary to set the PC correctly to display XGA and WXGA signal. Refer to page PC Resolution Horizontal Frequency Vertical Frequency VESA Standard PC VGA 720 x 400 31.469 kHz 70.087 Hz — 640 x 480 31.469 kHz 59.940 Hz O 37.861 kHz 72.809 Hz O 37.500 kHz 75.000 Hz O SVGA 800 x 600 35.156 kHz 56.250 Hz O 37.879 kHz 60.[...]
-
Страница 49
Appendix RS232 Port Speci fi cations PC control of the TV • Attach an RS-232C cable cross-type (commercially available) to the supplied Din/D-Sub RS-232C for the connections. This operation system should be used by a person who is accustomed to using computers. Communication conditions Set the RS-232C communication set tings on the PC to match t[...]
-
Страница 50
Information on the Software License for This Product ■ Software composition The software included in this product is comprised of various software components whose individual copyrights are held by SHARP or by third parties. ■ Software developed by SHARP and open source software The copyrights for the software components and various relevant do[...]
-
Страница 51
Legal notices ■ FCC Part 15 This device complies with Part 15 of the FCC Rules. Operation of this product is subject to the following two conditions: (1) this device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. This equipment has been test[...]
-
Страница 52
For location of the nearest Sharp Authorized Service, or to obtain product literature, accessories, supplies, or customer assistance, please call 1-800-BE-SHARP. LIMITED WARRANTY Calling for Service CONSUMER LIMITED WARRANTY SHARP ELECTRONICS CORPORA TION warrants to the first consumer purchaser that this Sharp brand Liquid Crystal Display product[...]
-
Страница 53
1 LC-32D59U LC-42D69U MANUEL DE L'UTILISATEUR IMPORTANT : Pour vous permettre de rapporter plus facilement la perte ou le vol de votre appareil, veuillez inscrire le numéro de modèle et le numéro de série du téléviseur dans l'espace prévu. Ces numéros sont situés à l'arrière du téléviseur. No de modèle : No de série : [...]
-
Страница 54
2 MARQUES DE COMMERCE INFORMATIONS IMPORTANTES A VERTISSEMENT : La Commission Fédérale des Communications précise que tout changement ou modi fi cation de l’appareil non expr essément approuvés par le fabricant risque d’annuler le droit de l’utilisateur à utiliser cet équipement. ATTENTION : POUR PRÉVENIR TOUT CHOC ÉLECTRIQUE, INTRO[...]
-
Страница 55
3 Merci d'avoir acheté ce téléviseur Sharp à écran à cristaux liquides. Pour assurer la sécurité et de nombreuses années de fonctionnement sans problème de votre appareil, veuillez lire les consignes de sécurité avant d'utiliser cet appareil. CHER CLIENT SHARP CONSIGNES DE SÉCURITÉ IMPORTANTES L énergie électrique peut ren[...]
-
Страница 56
4 CONSIGNES DE SÉCURITÉ IMPORTANTES 18) Dommages nécessitant une réparation—Débranchez l'appareil de la prise murale et confiez les réparations à un personnel de service qualifié dans le conditions suivantes : a) Lorsque le cordon d'alimentation ou la fiche est endommagé, b) Si du liquide a été renversé ou que des objets [...]
-
Страница 57
5 CONSIGNES DE SÉCURITÉ IMPORTANTES Eau et humidité — N'utilisez pas cet appareil près d'une source d'eau, par exemple, près d'une • baignoire, d'un lavabo, d'un évier, d'une laveuse, d'un sous-sol mouillé ou d'une piscine. Support — Ne placez pas l’appareil sur un chariot, un support, un [...]
-
Страница 58
6 CONSIGNES DE SÉCURITÉ IMPORTANTES Soins du châssis Utilisez un chiffon doux (coton, fl anelle, etc.) et frottez délicatement la surface du châssis. • L'utilisation d'un chiffon traité chimiquement (humide / chiffon sec de type feuille, etc.) peut • déformer les éléments du châssis ou causer des fi ssures. L'utilisat[...]
-
Страница 59
7 Félicitations pour votre achat! T out en profi tant de votr e nouveau produit, veuillez vous rappeler de ces conseils de sécuritéj: LE PROBLÈME L'attrait du cinéma maison est en croissance constante et les écrans plats s géants sont des achats populaires. Cependant, les écrans plats ne sont pas toujours installés sur les supports. [...]
-
Страница 60
3 2 32” 42” 32” 42” x4 8 RÉFÉRENCE RAPIDE Accessoires fournis REMARQUE Utilisez toujours le cordon d'alimentation fourni avec le téléviseur. • Les illustrations ci-dessus sont données à titre explicatif et peuvent varier légèrement • par rapport aux accessoires réels. Assurez-vous que les accessoires suivants sont fournis [...]
-
Страница 61
Cache-support 32’’/42’’ 9 RÉFÉRENCE RAPIDE Démontage de la colonne du support pour un montage mural CAUTION Veuillez faire attention lorsque vous démontez le châssis, le support et la • colonne pour monter le téléviseur au mur. Démontez la colonne du support dans le sens indiqué. • Ne la démontez pas du téléviseur à moins d[...]
-
Страница 62
10 Placez le téléviseur à proximité de la • prise électrique, et ararngez-vous pour que la fi che du cordon d'alimentation soit toujours à portée de main. Cet appareil ne doit être raccordé qu'à • une prise de 120 V, 60 Hz. Le connecter à tout autre type de prise peut endommager l'appareil et annuler la garantie. REMA[...]
-
Страница 63
I N P U T 4 5 6 7 8 9 / 0 E N T 2 D I S P L A Y F R E E Z E F LA S H B A C K MU TE S U R R O U N D TV U S B P C ME N U F A V O R I T E C H S L E E P C C V I E W M OD E A V M O D E A U D IO VOL C H + ` L C D T V G J 221 A B C D I NPU T 4 5 6 7 8 9 / 0 E N T 2 D I S P L A Y F R E E Z E FL ASHBACK M U T E S U R R O U N D T V U S B P C M E N U FA V O R[...]
-
Страница 64
12 Antennes Pour béné fi cier d'une image plus claire, utilisez une antenne extérieure. Ce qui suit est une brève explication des types de connexions qui sont utilisées pour un câble coaxial. Si votre antenne extérieure utilise un câble coaxial de 75 Ohms avec un connecteur de type F, branchez-le dans la prise d'antenne située ?[...]
-
Страница 65
13 Installation des piles dans la télécommande CAUTION Une utilisation incorrecte de piles peut entraîner des fuites ou une explosion des produits chimiques. Assurez-vous de bien vous conformer aux instructions ci-dessous. Ne mélangez pas les divers types de piles. Différents types de piles possèdent • différentes caractéristiques. Ne mé[...]
-
Страница 66
14 Contenu Schémas dimensionnels Les schémas dimensionnels pour la télévision LCD sont af fi chés à l'intérieur de la page • de couverture. INFORMATIONS IMPORTANTES .............................................................................. 1 MARQUES DE COMMERCE .....................................................................[...]
-
Страница 67
*2 *1 Y Y PB PB PR PR L- AUDIO -R L- AUDIO -R MENU CH INPUT POWER Bouton d'alimentation Bouton MENU Bouton d'entrée Boutons de volum ( VOL + / _ Boutons de chaîne ( CH / ) ) AC IN (ALIMENTATION CA) *3 VIDEO L- AUDIO -R VOL + RS-232C IOIOI +2 INPUT 1 INPUT 2 USB HEAD PHONE Borne INPUT 1 (ENTRÉE 1) (HDMI) Borne INPUT 2 (ENTRÉE 2) (HDMI)[...]
-
Страница 68
16 Télécommande Noms des pièces REMARQUE 1 I NPUT 3 4 5 6 7 8 9 / 0 ENT 1 2 DI SPLAY FR EEZE FL ASHBACK MUTE SURROUND TV USB PC M ENU FAVORIT E CH SLEEP CC V I E W M O D EA V MO DE AUDIO VOL CH + ` EX IT RETURN LCDTV GJ221 ABC D ENTER 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 P OWER • Lorsque vous utilisez la télécom[...]
-
Страница 69
17 Présentation des connexions Afficher des images en HD Un téléviseur HD sans source HD est juste un téléviseur ordinaire. Pour profiter d'images HD sur le téléviseur, vous devez employer une RTQITCOOCVKQP*&FWPGFGUOCPKÂTGUUWKXCPVGUa • Diffusion par antenne hertzienne de qualité HD • Abonnement au câble/s[...]
-
Страница 70
18 1 Appuyez sur le bouton INPUT. • L'écran affiche la liste des canaux. 2 Appuyez sur les boutons pour sélectionner la source d’entrée. • Vous pouvez également sélectionner la source d'entrée en appuyant sur le bouton INPUT (ENTRÉE) . Chaque fois que le bouton INPUT (ENTRÉE) est enfoncé,la source d'entrée change. •[...]
-
Страница 71
19 Connexion à un équipement externe Vous pouvez connecter différents types d'appareils externes à votre téléviseur. Pour afficher l'image d'une source externe,sélectionnez la source d'entrée à l'aide du bouton INPUT (ENTRÉE) de la télécommande ou du téléviseur. (Veuillez consulter les pages 18 et 25.) Pour co[...]
-
Страница 72
20 Connexion à un équipement externe #XGEWPE¸DNG%QORQUCPVG'064'a ● Lecteur de disque Blu-ray ● Lecteur DVD ● Décodeur de câble/satellite HD ● Pour utiliser l’écran à la résolution 1080p, branchez votre appareil externe à l’aide d’un câble certifié HDMI ou des câbles de composan[...]
-
Страница 73
21 Connexion à un équipement externe Connexion d'un amplificateur audio #XGEWPE¸DNGEQCZKCNa Il est possible d'émettre le signal audio sur les sorties DIGITAL AUDIO. Un signal audio PCM est émis sur ce connecteur. Connexion d'un amplificateur audio-vidéo Panneau arrière Entrées verticales DIGITAL AUDIO INPUT [...]
-
Страница 74
Brancher un ordinateur personnel Reportez-vous à la page 46 pour une liste des signaux PC compatibles avec le téléviseur. #XGEWPE¸DNG*&/+'064'QWa • Les bornes HDMI ne prennent en charge que des signaux numériques. #XGEWPE¸DNGFGEQPXGTUKQP&8+*&/+?[...]
-
Страница 75
23 Mise sous tension / hors tension Installation initiale Regarder la télévision Lorsque vous allumez le téléviseur pour la première fois, l'Installation initiale vous guidera à travers le processus d'installation. Effectuez les étapes suivantes avant d'appuyer sur le bouton POWER (ALIMENTATION) de la télécommande. 1. Insér[...]
-
Страница 76
24 Regarder la télévision 3. Réglage emplacement • Appuyez sur les boutons ▲ / ▼ pour sélectionner « Accueil » ou « Magasin » et appuyez sur le bouton ► pour passer à l'étape suivante. 4. Réglage du fuseau horaire • Appuyez sur les boutons ▲ / ▼ pour sélectionner votre emplacement actuel pour le fuseau horaire. 5. Ré[...]
-
Страница 77
⌃ I NPUT 3 4 5 6 7 8 9 / 0 ENT 1 2 DISPL AY FREEZE FLASH BACK MUTE SURROUND TV USB PC M ENU AUD IO VOL CH + ` P OWER FAVORITE CH SLEEP CC V IE W MO DEA V MO DE EX IT RETURN LCDTV GJ221 ABC D ENTER 25 Contrôle direct par les boutons Une image de la source sélectionnée s'af fi che automatiquement. • Chaque fois que le bouton • INPUT (E[...]
-
Страница 78
CANAL PRÉCÉDENT Appuyez sur le bouton FLASHBACK (CANAL PRÉCÉDENT) pour passer audernier canal affiché ou à la dernière source d'entrée sélectionnée. Appuyez de nouveau sur le bouton FLASHBACK (CANAL PRÉCÉDENT) pourrevenir au canal actuel ou à la source d'entrée actuelle. • SURROUND Cette fonction produit un effet Surround [...]
-
Страница 79
27 Contrôle direct par les boutons ■ Mode de diffusion audio numérique Les types d'audio transmis dans une émission numérique comprennent les modes SURROUND ainsi que MONO et STÉRÉO. De plus, il est possible que plusieurs pistes audio accompagnent une seule piste vidéo. Appuyez sur le bouton MTS/SAP pour basculer entre les modes audio[...]
-
Страница 80
24 VIEW MODE (MODE D'AFFICHAGE) ■ Pour les programmes au format 4:3 ■ Pour les programmes HD Stretch (Étirement) : Lorsque vous regardez des programmes au format 1.78:1, le mode d'étirement affiche deux bandes noires très minces en haut et en bas de l'écran. Dot by Dot (Point par point) (1080i/p seulement) : Détecte la réso[...]
-
Страница 81
29 Pour le mode TV REMARQUE Certains éléments du menu ne seront pas af fi chés en fonction de la source d'entrée • sélectionnée. Menu d'af fi chage à l'écran Éléments du menu Menu vidéo ........................................................... 31 Mode AV ...............................................................[...]
-
Страница 82
30 Exemple 1 ! Élément af fi ché en jaune Indique l'élément sélectionné. • Appuyez sur le bouton • pour ouvrir l'écran de réglage de cet élément. 2 Élément af fi ché en bleu Élément encadré Indique que l'élément peut être • sélectionné. Indique l'élément sélectionné. • 3 REMARQUE Les options d[...]
-
Страница 83
31 Menu d'af fi chage à l'écran Utilisation de la télécommande Utilisez les boutons suivants sur la télécommande pour contrôler le menu. Utilisation du panneau de contrôle du téléviseur Vous pouvez également contrôler le menu à partir du panneau de contrôle du téléviseur. Le fonctionnement des boutons du panneau de comman[...]
-
Страница 84
32 Menu d'af fi chage à l'écran Mode AV Permet d'ajuster l'apparence de l'image à partir de valeurs pré-réglées : Standard, Film, Economie d'énergie, Utilisateur ou Dynamic (Dynamique). Température de couleur Pour un meilleur équilibre des blancs, utilisez la correction de la températur e de couleur . • Pe[...]
-
Страница 85
33 Menu audio Permet de régler la qualité sonore selon vos préférences avec les paramètr es suivants. Appuyez sur le bouton 1. MENU pour af fi cher l'écran MENU, puis appuyez sur les boutons pour sélectionner l'élément « Audio » et en fi n appuyez sur le bouton Entrée ! ou ! ! pour y accéder. Appuyez sur les boutons 2. ! po[...]
-
Страница 86
34 Menu d'af fi chage à l'écran Menu TV Exemple Appuyez sur le bouton MENU pour af fi cher l'écran MENU, puis appuyez sur les boutons ▲ / ▼ pour sélectionner l'élément «TV» et en fi n appuyez sur le bouton Entrée ou ► pour y accéder. 1. !! Appuyez sur les boutons ▲ / ▼ pour sélectionner un élément de r?[...]
-
Страница 87
Réglez la date et l'heure manuellement. • Minuterie : Réglez la minuterie • pour allumer/éteindre le téléviseur automatiquement à une heure prédé fi nie. Minuterie de veille Cette option vous permet de con fi gurer l'heure à laquelle le téléviseur se met automatiquement en veille. (V oir page 25) Veille auto Réglez le t?[...]
-
Страница 88
• Opacité du Texte: Sélectionnez l'opacité du texte. • Couleur du Fond: Choisissez la couleur de l'arrière-plan des sous- titres. • Opacité du Fond: Choisissez l'une des options d'opacité de l'arrière-plan. • Couleur de la Fenêtre: Choisissez la couleur de la fenêtre d'af fi chage. • Opacité de la [...]
-
Страница 89
37 Menu d'af fi chage à l'écran Menu Parental Avant d'entr er dans le sous-menu Contrôle parental, l'utilisateur doit saisir le mot de passe. Une fois entré dans le sous-menu de contrôle parental, l'utilisateur peut modi fi er le tableau de restriction. Une fois sorti du sous-menu, la fonction de contrôle par ental [...]
-
Страница 90
38 Classement TV US Si vous recevez des canaux par un décodeur ou un décodeur de câble connecté par l'entrée HDMI, vous ne pouvez pas utiliser le blocage de classi fi cations des programmes télévisés. V otre décodeur ou décodeur de câble doit êtr e connecté par les connecteurs RF ou A V . Classi fi cation par âge Classi fi cat[...]
-
Страница 91
39 Classi fi cation du fi lm Description R Restreint. Les moins de 17 ans doivent êtr e accompagnés de leurs parents ou d'un tuteur adulte (l'âge peut varier dans certaines juridictions). NC-17 Les moins de 17 ans ne sont pas admis. X X est une ancienne notation qui a été uni fi ée avec la norme NC-17, mais peut être codée dans[...]
-
Страница 92
40 Classi fi cation du fi lm Description 18+ Adultes: Destiné aux téléspectateurs de 18 ans et plus; pourrait contenir des scènes de violence, qui bien que liées au développement de l'intrigue, aux personnages et aux thèmes, sont destinées aux adultes. Présence possible de langage graphique et de représentations sexuelles et de nud[...]
-
Страница 93
Ce téléviseur est équipé d'un connecteur USB qui vous permet d'afficher des photos, d'écouter de la musique et de lire des vidéos stockées sur unpériphérique de stockage USB. N a viguer dans le dossier de fichiers Appuyez sur le bouton USB. navigateur de fichiers miniatures du périphérique USB apparaît. 1. Photo Nom de fi[...]
-
Страница 94
FR 3FHBSEFSMFTQIPUPT Dans le navigateur des photos miniatures, appuyez sur les boutons ▲ / ▼ / ◄ / ► pour sélectionner une photo ou un album photo. Appuyez sur le bouton &/5&3 pour visualiser une image en plein écran. Le diaporama commence. Lorsque le diaporama commence, utilisez les bout[...]
-
Страница 95
FR 3FHBSEFSMFTQIPUPT Dans le navigateur des fi chiers miniatures, appuyez sur les boutons ▲ / ▼ / ◄ / ► pour sélectionner un fi chier vidéo. Appuyez sur le bouton &/5&3 pour lire le fi chier vidéo. Appuyez sur le bouton .&/6 pour af fi cher le sous-menu et sélectionnez les optio[...]
-
Страница 96
FR &ÃRCPPCIG "QQFOEJDF 2TQDNÂOG 5QNWVKQPRQUUKDNG o Absence de ten- sion. o Appuyez sur le bouton 219'4 de la télécommande. (voir page 23) Si le témoin du téléviseur reste allumé en rouge, appuyez sur le bouton 219'4 du téléviseur. o Est-ce que le cordon d'alimentation est débranché? (voir page [...]
-
Страница 97
FR 5RÃEKſECVKQPU o Dans le cadre de la politique d'amélioration continue, SHARP se réserve le droit d'apporter des modifications de conception et de spécifications pour l'amélioration des produits sans aucun préavis. Les valeurs indiquées pour les performances sont des valeurs nominales des appareils de productio[...]
-
Страница 98
FR 6CDNGCWFGEQORCVKDKNKVÃ2% DDC est une marque déposée de Video Electronics Standards Association. Il est nécessaire de configurer le PC correctement afin d'afficher le signal XGA et WXGA. Consultez la page 22 afin de définir les signaux d'entrée PC. #RRGPFKEG 2% 4ÃUQNWVKQP (TÃSWGPEG JQTKQPVCNGU (TÃSW[...]
-
Страница 99
FR Réponse anormale (erreur de communication ou commande incorrecte) (QTOCVFGNCEQOOCPFG Huit codes ASCII + CR Commande de 4 chiffres: Commande. Le texte de quatre caractères. Paramètre à 4 chiffres: Paramètre 0-9, x, blanc, ? 2CTCOÂVTG Saisissez les valeurs des paramètres, en les alignant à gauche, et remplissez de b[...]
-
Страница 100
FR +PHQTOCVKQPUWTNCNKEGPEGFWNQIKEKGNFGEGRTQFWKV #RRGPFKEG ■ %QORQUKVKQPFWNQIKEKGN ■ .QIKEKGNUFÃXGNQRRÃURCT5JCTRGVNQIKEKGNUQRGPUQWTEG ■ 1DVGPKTNGEQFGUQWTEG ■ 4GOGTEKGOGPVU 57224'55+10&7/16&'2#55'/#¡64' Le logicie[...]
-
Страница 101
FR /GPVKQPUNÃICNGU #RRGPFKEG ■ %(%2CTVKG ■ #XGTVKUUGOGPVFGNC%(% ■ %¸DNGU ■ #XKUECPCFKGP ■ &1.$; ■ &1.$; Cet appareil est conforme à la partie 15 des règlements de la CFC. Son fonctionnement est sou- mis aux deux conditions suivantes : (1) Cet appareil ne doit pas causer d’interfé[...]
-
Страница 102
FR "QQFMFSQPVSEFMBJEF ("3"/5*&-*.*5& Pour connaître l'emplacement du centre de service autorisé Sharp le plus proche de chez vous, ou pour obtenir de la documentation, des accessoires, des fournitures ou un support technique, veuillez appeler le 1-800-BE-SHARP. POUR OBTENIR DES INFORMATIONS SUR[...]
-
Страница 103
1 LC-32D59U LC-42D69U MANUAL DE FUNCIONAMIENTO IMPORTANTE: Para facilitar la realización de informes en caso de pérdida o robo, registre el modelo y el número de serie de la TV en el espacio proporcionado. Estos números están ubicados en la parte posterior de la TV. Núm. de modelo: Núm. de serie: TV DE CRISTAL LÍQUIDO ESPAÑOL INFORMACIÓN [...]
-
Страница 104
2 INFORMACIÓN IMPORTANTE MARCAS COMERCIALES ADVERTENCIA: Las r egulaciones de la FCC señalan que cualquier cambio o modi fi cación no autorizado en este equipo que no hayan sido expresamente apr obados por el fabricante podría anular la autorización del usuario para utilizar este equipo. PRECAUCIÓN: PARA EVITAR DESCARGAS ELÉCTRICAS, HAGA CO[...]
-
Страница 105
3 Gracias por adquirir la TV de cristal líquido Sharp. Para garantizar la seguridad y muchos años de funcionamiento sin problemas del producto, lea detenidamente la sección INTRUCCIONES IMPORTANTES DE SEGURIDAD antes de utilizar el producto. ESTIMADO CLIENTE DE SHARP INSTRUCCIONES IMPORTANTES DE SEGURIDAD La electricidad se usa para realizar muc[...]
-
Страница 106
4 INSTRUCCIONES IMPORTANTES DE SEGURIDAD 17) Entrada de objetos y líquidos — No meta nunca objetos de ninguna clase en este producto a través de las aberturas porque pueden tocar puntos de alto voltaje peligr osos o cortocircuitar partes que podrían causar un incendio o una descarga eléctrica. No derrame nunca líquidos de ningún tipo sobre [...]
-
Страница 107
5 INSTRUCCIONES IMPORTANTES DE SEGURIDAD Agua y humedad — No utilice este producto cerca del agua como, por ejemplo, una bañera, s palangana, fregadero de cocina o lavadora; en un sótano húmedo; cerca de una piscina o un lugar similar. Soporte — No coloque el producto en un carrito, soporte, trípode o mesa inestable. La s colocación del pr[...]
-
Страница 108
6 INSTRUCCIONES IMPORTANTES DE SEGURIDAD Para evitar un incendio o una descarga eléctrica, no exponga este producto a • goteo ni a las salpicaduras. Tampoco deberán ponerse encima del producto objetos llenos de líquidos como, por ejemplo, fl oreros. No introduzca ningún tipo de objeto en el producto. Introducir objetos por las • aberturas [...]
-
Страница 109
7 INSTRUCCIONES IMPORTANTES DE SEGURIDAD SEGURIDAD DE LOS NIÑOS Cómo y dónde utilizar la pantalla de panel plano hace realmente la diferencia ¡Felicitaciones por su compra! Mientras disfruta de su nuevo producto, tenga en cuenta estas recomendaciones de seguridad: EL PROBLEMA La experiencia de entretenimiento de cine en casa es una tendencia ca[...]
-
Страница 110
4 3 32” 42” 32” 42” x4 8 REFERENCIA RÁPIDA Accesorios suministrados Utilice siempre el cable de alimentación de CA suministrado con la TV. • Las ilustraciones que aparecen anteriormente poseen sólo fi nes explicativos y pueden • variar ligeramente de los accesorios reales. Asegúrese de que los siguientes accesorios estén incluidos[...]
-
Страница 111
Cubierta de la base 32’’/42’’ 9 REFERENCIA RÁPIDA Extracción del cuello de la base para el montaje en pared Tenga cuidado al desarmar el armario, base y columna para el montaje en • pared. Extraiga el cuello de la base en la dirección correcta. • No extraiga el cuello de la base de la TV a menos de desee utilizar un soporte • de pa[...]
-
Страница 112
Toma de CA 10 Sugerencias para la instalación rápida Coloque la antena en la parte posterior de la TV. (Consulte la página 12). Encendido de la TV por primera vez. A) Presione POWER (ENCENDIDO/ APAGADO) en la TV. B) El indicador POWER (ENCENDIDO/ APAGADO) ubicado en la parte frontal de la TV se apaga. Conecte el enchufe de CA de la TV en un toma[...]
-
Страница 113
I N P U T 4 5 6 7 8 9 / 0 E N T 2 D I S P L A Y F R E E Z E F LA S H B A C K M U TE S U R R O UN D TV U S B P C ME N U F A V O R I T E C H S L E E P C C V I E W M OD E A V M O DE A U D IO VOL C H + ` L C D T V G J 2 21 A B C D I NPU T 4 5 6 7 8 9 / 0 E N T 2 D I S P L A Y FR E E Z E F L ASHB ACK M U T E S U R R O U N D T V U S B P C M E N U F AV O [...]
-
Страница 114
12 Antenas Para disfrutar de una imagen más nítida, utilice una antena exterior. A continuación, se realiza una explicación breve sobre los tipos de conexiones utilizados para un cable coaxial. Si la antena exterior utiliza un cable coaxial de 75 ohmios con un conector tipo F, conéctelo en el terminal de antena ubicado en la parte posterior de[...]
-
Страница 115
13 Instalación de las pilas en el control remoto La utilización incorrecta de las pilas podría derivar en fugas químicas o explosiones. Asegúrese de seguir las instrucciones que aparecen a continuación. No mezcle pilas de diferentes tipos. Los diferentes tipos de pilas poseen diferentes • características. No mezcle pilas usadas con nuevas.[...]
-
Страница 116
14 Contenido Ilustraciones dimensionales Las ilustraciones dimensionales para la TV LCD aparecen en la contratapa interior. • INFORMACIÓN IMPORTANTE ................................................................................... 1 MARCAS COMERCIALES ........................................................................................... 2[...]
-
Страница 117
*2 *1 Y Y PB PB PR PR L- AUDIO -R L- AUDIO -R MENU CH INPUT POWER ( VOL + / _ ( CH / ) ) *3 VIDEO L- AUDIO -R VOL + RS-232C IOIOI AC IN *1 Sensor de luz INPUT 1 INPUT 2 USB HEAD PHONE INPUT 1 terminal (HDMI) INPUT 2 terminal (HDMI) HEAD PHONE USB DIGITAL AUDIO 15 Sensor del control remoto Indicador de ENCENDIDO/AP AGADO Nombres de las partes TV (pa[...]
-
Страница 118
1 I NPUT 3 4 5 6 7 8 9 / 0 ENT 1 2 DI SPLAY FR EEZE FL ASHBACK MUTE SURROUND TV USB PC M ENU FA V ORITE CH SLEEP CC V I E W M O D EA V MO D E AUDIO VOL CH + ` EX IT RETURN LCDTV GJ221 ABC D ENTER 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 P OWER 16 Control remoto Nombres de las partes Al utilizar el control remoto, apunte ha[...]
-
Страница 119
17 Introducción a las conexiones Experiencia con imágenes en alta definición Una TV de alta definición sin una fuente de alta definición es simplemente una TV normal. Para disfrutar imágenes en alta definición, deberá obtener una programación de alta definición a partir de las siguientes fuentes: • Transmisión por aire a través de una[...]
-
Страница 120
ES 18 1 Presione el botón INPUT (ENTRADA). • Aparecerá la pantalla CH List (Lista de canales). 2 Presione el botón para seleccionar la fuente de entrada. • También puede seleccionar la fuente de entrada presionando el botón INPUT (ENTRADA) . Cada vez que se presione el botón INPUT (ENTRADA) , se cambiará la fuente de entrada. • Aparece[...]
-
Страница 121
ES 19 Conexión de los equipos externos Puede conectar varios tipos de equipos externos en la TV.Para visualizar imágenes de fuentes externas, seleccione la fuente de entrada utilizando el botón entrada en el control remoto o el botón INPUT (ENTRADA) en la TV. (Consulte las páginas 18 y 25).Para la conexión de la TV con equipos externos, utili[...]
-
Страница 122
ES 20 Conexión de los equipos externos Al utilizar el cable de video componente (INPUT (ENTRADA) 5, 6): ● Reproductor de Blu-ray Disc ● Reproductor de DVD ● Sintonizador de TV por cable/satelital de alta definición ● Para disfrutar de una visualización 1080p, conecte el equipo externo utilizando un cable HDMI certificado o un cable de vi[...]
-
Страница 123
ES 21 Conexión de los equipos externos Conexión de un amplificador de audio Al utilizar un cable coaxial: Es posible transmitir audio a través del terminal DIGITAL AUDIO (AUDIO DIGITAL). Se emite audio PCM desde el terminal. Conexión de un amplificador de audio/video er Entradas verticales del panel posterior ENTRADA DE AUDIO DIGITAL ÓPTICA Ca[...]
-
Страница 124
Conexión de una PC Consulte la página 46 para obtener una lista de las señales de PC compatibles con la TV. Al utilizar el cable HDMI (INPUT (ENTRADA) 1, 2, 3 o 4): • Los terminales HDMI sólo admiten señales digitales. Al utilizar un cable de conversión DVI-HDMI (INPUT (ENTRADA) 1, 2, 3 o 4): • Al utilizar un cable de conversión DVI-HDMI[...]
-
Страница 125
EX I T RETURN ENTER 1 2 P OWER VOL + - MENU < CH < INPUT POWER 23 Encendido/apagado Con fi guración inicial ENCENDIDO/ APAGADO Visualización de la TV Cuando encienda la TV por primera vez, Con fi guración inicial lo guiará por el proceso de con fi guración. Realice los siguientes pasos antes de presionar POWER (ENCENDIDO/APAGADO) en e[...]
-
Страница 126
24 Visualización de la TV 3. Con fi guración de ubicación Presione el botón • ▲ / ▼ ▲▼ ▲▼ para seleccionar “Inicio” o “Almacenar” y presione el botón para avanzar al próximo paso. 4. Con fi guración de Zona horaria Presione •/ para seleccionar su ubicación actual para el establecimiento de la zona horaria. 5. Con ?[...]
-
Страница 127
I NPUT 3 4 5 6 7 8 9 / 0 ENT 1 2 DISPL AY FREEZE FL ASHBACK MUTE SURROUND TV USB PC MENU AUD IO VOL CH + ` P OWER FAVORITE CH SLEEP CC V IE W MO DEA V MOD E EXI T RETURN LCDTV GJ221 ABC D ENTER 25 Utilización directa de los botones Cada vez que se presione el botón • INPUT (ENTRADA) , se cambiará la fuente de entrada. Si presiona el botón •[...]
-
Страница 128
26 Utilización directa de los botones CANAL ANTERIOR Presione el Presione el botón FLASHBACK (CANAL ANTERIOR) para cambiar al canal o entrada sintonizada previamente. Presione nuevamente el botón FLASHBACK (CANAL ANTERIOR) paracambiar al canal o entrada sintonizado actualmente. • SONIDO ENVOLVENTE La función de sonido envolvente otorga un efe[...]
-
Страница 129
27 Utilización directa de los botones Puede cambiar el MTS como se muestra a continuación para ajustarlo a la señal de transmisión de televisión. Presione el botón AUDIO para cambiar entre los modos de audio. Ejemplos: al recibir MTS y SAP Modo PRINCIPAL + SAP: Modo MONO: MONO ■ Modo de audio de transmisión digital Los tipos de audio trans[...]
-
Страница 130
28 MODO DE VISUALIZACIÓN Puede seleccionar el tamaño de la pantalla. ■ Para programas en 4:3 Ejemplo: imágenes de los tamaños de pantalla Punto de Dot Punto de Dot La imagen cubre toda la pantalla. Detecta la resolución de la señal y muestra la imagen con la misma cantidad de píxeles en la pantalla. Utilización directa de los botones 1 Pr[...]
-
Страница 131
29 Para el modo TV Algunos elementos del menú podrían no aparecen en función de la fuente de entrada • seleccionada. Menú de visualización en pantalla Elementos del menú Menú Video ........................................................... 31 Modo AV ................................................................. 32 Temperatura de color[...]
-
Страница 132
Vídeo Audio TV Congur De los Padres Video Modo AV Brillo Contraste Matiz Nitidez Temperatura de color Vídeo avanzado Sensor de luz ambiental Usuario 50 50 50 0 10 Si Enter Intro Selecto REGRESAR Salida Saturación 1 2 3 Vídeo Audio TV Congur De los Padres Video Modo AV Brillo Contraste Matiz Nitidez Temperatura de color Vídeo avanzado Sen[...]
-
Страница 133
31 Menú de visualización en pantalla Botones para la navegación por el menú Utilización del control remoto Utilice los siguientes botones en el control remoto para navegar por el menú. CH ⌃ ⌃ /: Cursor ▼ / ▲ ▼▲ ▼▲ ◄► ◄► ► ► en el control remoto. VOL + / - : Cursor / en el control remoto. MENU (MENÚ): MENU (MENÚ) [...]
-
Страница 134
32 Menú de visualización en pantalla Modo AV Ajuste la mejor apariencia de imagen seleccionando el valor predeterminado Estándar , Película , Ahorro de energía , Usuario o Deportes . Temperatura de color Para un mejor balance de blancos, utilice la corrección de la temperatura de color . Cálida: Blanco con tonos rojizos Estándar: Fría: Bla[...]
-
Страница 135
33 Menú Audio Permite ajustar la calidad del sonido a su prefer encia a través de las siguientes con fi guraciones. Ejemplo Presione el botón 1. MENU (MENÚ) para visualizar la pantalla MENÚ y, a continuación, presione el botón ▲ / ▼ ▲▼ para seleccionar “Audio” y presione el botón Intro ! o !! para ingresar. Presione 2. / ! para[...]
-
Страница 136
34 Menú de visualización en pantalla Menú TV Ejemplo Presione el botón 1. MENU (MENÚ) para visualizar la pantalla MENÚ y, a continuación, presione el botón ▲ / ▼ ▲▼ ▲▼ ▲▼ ▲▼ ► ► para seleccionar “TV” y presione el botón Intro ! o !! para ingresar. Presione el botón 2. / ! para seleccionar un elemento especí ?[...]
-
Страница 137
▲ ▼ ▲ ▼ ► ► 35 Menú de visualización en pantalla Con fi guración Ejemplo Presione el botón 1. MENU (MENÚ) para visualizar la pantalla MENÚ y, a continuación, presione el botón / para seleccionar “ Con fi guración ” y presione el botón Intro o para ingresar. Presione el botón 2. / para seleccionar un elemento especí fi[...]
-
Страница 138
36 Menú de visualización en pantalla Subtítulos Digitales Permite con fi gurar la forma en la que desea visualizar los subtítulos ocultos digitales. Seleccione uno de los canales de servicio digital propor cionados por el proveedor de los subtítulos ocultos. Existen seis servicios estándares. Servicio 1 está designado como el servicio de su[...]
-
Страница 139
37 Menú de visualización en pantalla Menú Paterno Antes de ingresar en el submenú Contr ol pater no, el usuario deberá ingresar primer o la contraseña. Luego de ingresar en este submenú, el usuario puede modi fi car la tabla de restricciones. Al salir de este submenú, se activará la función de contr ol pater no. Ingrese una contraseña d[...]
-
Страница 140
38 Clasif. TV en EEUU (Clasi fi cación de TV de Estados Unidos) Si recibe canales a través de un sintonizador o r eceptor de TV por cable conectado a través de HDMI, no podrá utilizar el bloqueo de clasi fi cación de la TV . El sintonizador o el receptor de TV por cable deberá estar conectado a través de conexiones RF o A V . Clasi fi cac[...]
-
Страница 141
39 Menú de visualización en pantalla Clasi fi cación de la película Descripción PG-13 Advertencia para los padres. Algunos materiales podrían ser inapropiados para niños menor es de 13 años. R Restringida. Las personas menores de 17 años deberán estar acompañadas por un padre o tutor adulto (la edad varía en algunas jurisdicciones). NC[...]
-
Страница 142
40 Clasi fi cación de la película Descripción 18+ Adultos: apto para mayores de 18 años y podría contener repr esentaciones violentas que, a pesar de estar relacionadas con el desarrollo del argumento o personaje, son adecuadas para la visualización por parte de adultos. Podría contener lenguaje grá fi co y escenas de sexo y desnudez. Cla[...]
-
Страница 143
Esta TV incluye un conector USB que permite visualizar imágenes, reproducir música y videos almacenados en un dispositivo de almacenamiento USB. Presione el botón directo USB. Aparecerá el explorador de vistas en miniatura de USB. 1. Fotografía Nombre de archivo 1 Tipo de medio Tamaño Ordenar 01/01 Nombre de archivo 1 Nombre de archivo 2 Nomb[...]
-
Страница 144
ES 42 Visualización de imágenes 1. ! En el explorador de vistas en miniatura de imágenes, presione los botones ▲ / ▼ / ◄ / ► para seleccionar una imagen o álbum de imágenes. 2. ! Presione ENTER (ACEPTAR) para visualizar la imagen en pantalla completa. Se iniciará la presentación. 3. ! Cuando comience la presentación, utilice los bot[...]
-
Страница 145
ES 7JTVBMJ[BDJÊOEFJN¸HFOFT En el explorador de vistas en miniatura de archivos, presione los botones ▲ / ▼ / ◄ / ► para seleccionar un archivo de video. Presione el botón &/5&3"$&15"3 para reproducir el archivo de video. Presione el botón .&/6.&/±?[...]
-
Страница 146
ES 4GUQNWEKÎPFGRTQDNGOCU "QÀOEJDF 2TGECWEKQPGUTGNCEKQPCFCUEQPNCWVKNKCEKÎPFGNC68GPGPVQTPQUFGVGORGTCVWTCUCNVCU[DCLCU o Cuando se utiliza la TV en ambientes de baja temperatura (por ejemplo, una habitación u oficina), la imagen podría dejar rastros o mostrarse ligeramente retrasad[...]
-
Страница 147
ES 'URGEKſECEKQPGU o SHARP sigue una política de mejoras continuas, por lo tanto, se reserva el derecho de hacer cambios en el diseño y en las especificaciones, para mejorar el producto, sin previo aviso. Las cifras de las especificaciones del rendimiento indicadas son valores nominales de las unidades de producción. Es posibl[...]
-
Страница 148
ES 6CDNCFGEQORCVKDKNKFCFEQP2% DDC es una marca registrada de Video Electronics Standards Association. Es necesario ajustar correctamente el PC para visualizar señal XGA y WXGA. Para el ajuste de las señales de entrada al PC, consulte la página 22. #RÃPFKEG 2% 4GUQNWEKÎP *QTKQPVCN (TGEWGPEKC (TGEWGPEKCXGTVKECN &a[...]
-
Страница 149
ES Problema de la respuesta (error de comunicación o comando incorrecto) (QTOCVQFGNEQOCPFQ Ocho códigos ASCII + CR Comando de 4 dígitos: comando. Texto de los cuatro caracteres. Parámetro de 4 dígitos: parámetro 0–9, x, vacío, ? 2CT¶OGVTQ Ingrese los valores del parámetro, alineando hacia la izquierda, y complete con[...]
-
Страница 150
ES +PHQTOCEKÎPUQDTGNCNKEGPEKCFGUQHVYCTGRCTCGUVGRTQFWEVQ #RÃPFKEG ■ %QORQUKEKÎPFGNUQHVYCTG ■ 5QHVYCTGFGUCTTQNNCFQRQT5*#42[UQHVYCTGNKDTG ■ 1DVGPEKÎPFGNEÎFKIQHWGPVG ■ 4GEQPQEKOKGPVQU $144#&1&'.#%106#5'¤#/#'564# El software in[...]
-
Страница 151
Avisos legales Apéndice ■ Apartado 15 de la FCC ■ Advertencia relacionada con la normativa FCC ■ Cables ■ Aviso para Canadá ■ DOLBY ■ DOLBY Este dispositivo cumple con el Apartado 15 de las Normas FCC. Su funcionamiento está sujeto a las dos condiciones siguientes: (1) Este dispositivo no deberá causar interferencias perjudiciales y[...]
-
Страница 152
ES $POUBDUPDPOFMTFSWJDJPUÀDOJDP ("3"/5¤"-*.*5 "%" Para ubicar el servicio técnico autorizado más cercano de Sharp, o para obtener literatura acerca del producto, información acerca de los accesorios, suministros o asistencia al cliente por favor comuníquese al 1-800-BE-SHARP. PARA OBTENER INFORMA[...]
-
Страница 153
[...]
-
Страница 154
[...]
-
Страница 155
Dimensional Drawings 20 31 / 64 (520) 40 23 / 32 (1034) 40 3 / 4 (1035) 5 (127) 3 25 / 64 (86) 11 15 / 64 (285) 15 3 / 4 (400) 36 5 / 8 (930.24) 20 39 / 64 (523.26) 15 7 / 16 (392) 25 29 / 32 (658) 5 11 / 64 (131) 27 49 / 64 (705) 7 7 / 8 (200) LC-42D69U Unit: inch (mm) Unité: pouce (mm) Unidad: pulgada (mm)[...]
-
Страница 156
Dimensional Drawings 16 35 / 64 (420) 31 35 / 64 (801) 31 37 / 64 (802) 3 7 / 16 10 3 / 64 (87) 3 25 / 64 (86) (255) 27 15 / 32 (697.68) 15 29 / 64 (392.26) 12 27 / 32 (326) 20 3 / 4 (527) 4 49 / 64 (121) 22 39 / 64 (574) 7 7 / 8 (200) 7 7 / 8 (200) LC-32D59U Unit: inch (mm) Unité: pouce (mm) Unidad: pulgada (mm)[...]
-
Страница 157
SHARP ELECTRONICS CORPORA TION Sharp Plaza, Mahwah, New Jersey 07495-1163 SHARP CORPORA TION Printed in China Imprimé au Chine Impreso en China 50652T421S00R(A) H K[...]